Lineage for d2w60b2 (2w60 B:113-217)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2752368Domain d2w60b2: 2w60 B:113-217 [206638]
    Other proteins in same PDB: d2w60a_, d2w60b1
    automated match to d2fd6l2
    complexed with no3

Details for d2w60b2

PDB Entry: 2w60 (more details), 1.5 Å

PDB Description: anti citrullinated collagen type 2 antibody acc4
PDB Compounds: (B:) anti-citrullinated collagen type II fab acc4

SCOPe Domain Sequences for d2w60b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w60b2 b.1.1.2 (B:113-217) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

SCOPe Domain Coordinates for d2w60b2:

Click to download the PDB-style file with coordinates for d2w60b2.
(The format of our PDB-style files is described here.)

Timeline for d2w60b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2w60b1
View in 3D
Domains from other chains:
(mouse over for more information)
d2w60a_