SCOPe 2.08: Domain d2w60b2: 2w60 B:113-217

Lineage for d2w60b2 (2w60 B:113-217)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d2w60b2: 2w60 B:113-217 [206638]
   Other proteins in same PDB: d2w60a_, d2w60b1
   automated match to d2fd6l2
   complexed with no3

Details for d2w60b2

PDB Entry: 2w60, 1.5 Å

PDB Description: anti citrullinated collagen type 2 antibody acc4

PDB Compounds: (B:) anti-citrullinated collagen type II fab acc4

SCOPe Domain Sequences for d2w60b2:

Sequence; same for both SEQRES and ATOM records:

>d2w60b2 b.1.1.2 (B:113-217) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

Timeline for d2w60b2:

• d2w60b2 first appeared in SCOPe 2.03
  
• d2w60b2 appears in SCOPe 2.07