Lineage for d2w60b2 (2w60 B:113-217)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2352435Protein automated matches [190374] (14 species)
    not a true protein
  7. 2353824Species Mouse (Mus musculus) [TaxId:10090] [224855] (510 PDB entries)
  8. 2353881Domain d2w60b2: 2w60 B:113-217 [206638]
    Other proteins in same PDB: d2w60b1
    automated match to d2fd6l2
    complexed with no3

Details for d2w60b2

PDB Entry: 2w60 (more details), 1.5 Å

PDB Description: anti citrullinated collagen type 2 antibody acc4
PDB Compounds: (B:) anti-citrullinated collagen type II fab acc4

SCOPe Domain Sequences for d2w60b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w60b2 b.1.1.2 (B:113-217) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

SCOPe Domain Coordinates for d2w60b2:

Click to download the PDB-style file with coordinates for d2w60b2.
(The format of our PDB-style files is described here.)

Timeline for d2w60b2: