Lineage for d2w60b1 (2w60 B:1-112)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2759568Domain d2w60b1: 2w60 B:1-112 [206637]
    Other proteins in same PDB: d2w60a_, d2w60b2
    automated match to d2fatl1
    complexed with no3

Details for d2w60b1

PDB Entry: 2w60 (more details), 1.5 Å

PDB Description: anti citrullinated collagen type 2 antibody acc4
PDB Compounds: (B:) anti-citrullinated collagen type II fab acc4

SCOPe Domain Sequences for d2w60b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w60b1 b.1.1.0 (B:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvvmtqtpltlsvtigqpasisckssqslldsdgktylnwllqrpgqspkrliylvskld
sgvpdrftgsgsgtdftlkisrveaedlgvyycwqgthfpltfgagtklelk

SCOPe Domain Coordinates for d2w60b1:

Click to download the PDB-style file with coordinates for d2w60b1.
(The format of our PDB-style files is described here.)

Timeline for d2w60b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2w60b2
View in 3D
Domains from other chains:
(mouse over for more information)
d2w60a_