Lineage for d2w59a2 (2w59 A:452-566)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754067Species Chicken (Gallus gallus) [TaxId:9031] [188287] (28 PDB entries)
  8. 2754080Domain d2w59a2: 2w59 A:452-566 [206631]
    automated match to d1fp5a2
    complexed with gol

Details for d2w59a2

PDB Entry: 2w59 (more details), 1.75 Å

PDB Description: structure of an avian igy-fc 3-4 fragment
PDB Compounds: (A:) igy fcu3-4

SCOPe Domain Sequences for d2w59a2:

Sequence, based on SEQRES records: (download)

>d2w59a2 b.1.1.0 (A:452-566) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
pttppliypfaphpeelslsrvtlsclvrgfrprdieirwlrdhravpatefvttavlpe
ertangaggdgdtffvyskmsvetakwnggtvfacmavhealpmrfsqrtlqkqa

Sequence, based on observed residues (ATOM records): (download)

>d2w59a2 b.1.1.0 (A:452-566) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
pttppliypfaphpeelslsrvtlsclvrgfrprdieirwlrdhravpatefvttavlpe
ertangdgdtffvyskmsvetakwnggtvfacmavhealpmrfsqrtlqkqa

SCOPe Domain Coordinates for d2w59a2:

Click to download the PDB-style file with coordinates for d2w59a2.
(The format of our PDB-style files is described here.)

Timeline for d2w59a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2w59a1