SCOPe 2.08: Domain d2w59a1: 2w59 A:349-451

Lineage for d2w59a1 (2w59 A:349-451)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [188287] (28 PDB entries)

8. Domain d2w59a1: 2w59 A:349-451 [206630]
   automated match to d1fp5a1
   complexed with gol

Details for d2w59a1

PDB Entry: 2w59, 1.75 Å

PDB Description: structure of an avian igy-fc 3-4 fragment

PDB Compounds: (A:) igy fcu3-4

SCOPe Domain Sequences for d2w59a1:

Sequence; same for both SEQRES and ATOM records:

>d2w59a1 b.1.1.0 (A:349-451) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
piqlyaippspgelyisldaklrclvvnlpsdsslsvtwtreksgnlrpdpmvlqehfng
tysassavpvstqdwlsgerftctvqheelplplsksvyrntg

Timeline for d2w59a1:

• d2w59a1 first appeared in SCOPe 2.03
  
• d2w59a1 appears in SCOPe 2.07