SCOPe 2.01: Domain d1i1aa1: 1i1a A:179-269

Lineage for d1i1aa1 (1i1a A:179-269)

Root: SCOPe 2.01
Class b: All beta proteins [48724] (174 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein Fc (IgG) receptor, alpha-3 domain [88612] (2 species)
Species Norway rat (Rattus norvegicus) [TaxId:10116] [88613] (3 PDB entries)
Domain d1i1aa1: 1i1a A:179-269 [20663]
Other proteins in same PDB: d1i1aa2, d1i1ab_, d1i1ac1, d1i1ac2, d1i1ad1, d1i1ad2
complexed with cys, nag, ndg

Details for d1i1aa1

PDB Entry: 1i1a (more details), 2.8 Å

PDB Description: crystal structure of the neonatal fc receptor complexed with a heterodimeric fc

PDB Compounds: (A:) neonatal fc receptor a

SCOPe Domain Sequences for d1i1aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i1aa1 b.1.1.2 (A:179-269) Fc (IgG) receptor, alpha-3 domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
keppsmrlkarpgnsgssvltcaafsfyppelkfrflrnglasgsgncstgpngdgsfha
wsllevkrgdehhyqcqveheglaqpltvdl

SCOPe Domain Coordinates for d1i1aa1:

Click to download the PDB-style file with coordinates for d1i1aa1.
(The format of our PDB-style files is described here.)

Timeline for d1i1aa1: