Class b: All beta proteins [48724] (165 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Fc (IgG) receptor, alpha-3 domain [88612] (2 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [88613] (3 PDB entries) |
Domain d1i1aa1: 1i1a A:179-269 [20663] Other proteins in same PDB: d1i1aa2, d1i1ab_, d1i1ac1, d1i1ac2, d1i1ad1, d1i1ad2 complexed with cys, fuc, man, nag; mutant |
PDB Entry: 1i1a (more details), 2.8 Å
SCOP Domain Sequences for d1i1aa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i1aa1 b.1.1.2 (A:179-269) Fc (IgG) receptor, alpha-3 domain {Rat (Rattus norvegicus) [TaxId: 10116]} keppsmrlkarpgnsgssvltcaafsfyppelkfrflrnglasgsgncstgpngdgsfha wsllevkrgdehhyqcqveheglaqpltvdl
Timeline for d1i1aa1: