SCOP 1.57: Domain d1i1aa1: 1i1a A:179-269

Lineage for d1i1aa1 (1i1a A:179-269)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Fc (IgG) receptor, alpha-3 domain and beta subunit [48943] (1 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [48944] (3 PDB entries)

8. Domain d1i1aa1: 1i1a A:179-269 [20663]
   Other proteins in same PDB: d1i1aa2, d1i1ac1, d1i1ac2, d1i1ad1, d1i1ad2

Details for d1i1aa1

PDB Entry: 1i1a, 2.8 Å

PDB Description: crystal structure of the neonatal fc receptor complexed with a heterodimeric fc

SCOP Domain Sequences for d1i1aa1:

Sequence; same for both SEQRES and ATOM records:

>d1i1aa1 b.1.1.2 (A:179-269) Fc (IgG) receptor, alpha-3 domain and beta subunit {Rat (Rattus norvegicus)}
keppsmrlkarpgnsgssvltcaafsfyppelkfrflrnglasgsgncstgpngdgsfha
wsllevkrgdehhyqcqveheglaqpltvdl

Timeline for d1i1aa1:

• d1i1aa1 first appeared (with stable ids) in SCOP 1.55
  
• d1i1aa1 appears in SCOP 1.59
  
• d1i1aa1 appears in the current release, SCOPe 2.08