| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families) ![]() contains similar fold but lacks its catalytic centre |
| Family d.92.2.3: Hyaluronidase N-terminal domain-like [143618] (2 proteins) |
| Protein Glucosaminidase GH84, N-terminal domain [143621] (1 species) |
| Species Bacteroides thetaiotaomicron [TaxId:818] [143622] (8 PDB entries) Uniprot Q89ZI2 25-147 |
| Domain d2w4xa1: 2w4x A:4-126 [206625] Other proteins in same PDB: d2w4xa2, d2w4xa3 automated match to d2j47a3 complexed with ca, gol, stz |
PDB Entry: 2w4x (more details), 2.42 Å
SCOPe Domain Sequences for d2w4xa1:
Sequence, based on SEQRES records: (download)
>d2w4xa1 d.92.2.3 (A:4-126) Glucosaminidase GH84, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]}
slqpppqqlivqnktidlpavyqlnggeeanphavkvlkellsgkqsskkgmlisigekg
dksvrkysrqipdhkegyylsvnekeivlagndergtyyalqtfaqllkdgklpeveikd
yps
>d2w4xa1 d.92.2.3 (A:4-126) Glucosaminidase GH84, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]}
slqpppqqlivqnktidlpavyqlnggeeanphavkvlkellsgmlisigekgdksvrky
srqipdhkegyylsvnekeivlagndergtyyalqtfaqllkdgklpeveikdyps
Timeline for d2w4xa1: