| Class b: All beta proteins [48724] (93 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
| Protein Fc (IgG) receptor, alpha-3 domain and beta subunit [48943] (1 species) |
| Species Rat (Rattus norvegicus) [TaxId:10116] [48944] (3 PDB entries) |
| Domain d3fruf1: 3fru F: [20662] Other proteins in same PDB: d3frua2, d3fruc2, d3frue2 |
PDB Entry: 3fru (more details), 2.2 Å
SCOP Domain Sequences for d3fruf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fruf1 b.1.1.2 (F:) Fc (IgG) receptor, alpha-3 domain and beta subunit {Rat (Rattus norvegicus)}
iqktpqiqvysrhppengkpnflncyvsqfhppqieiellkngkkipniemsdlsfskdw
sfyilahteftptetdvyacrvkhvtlkepktvtwdrdm
Timeline for d3fruf1: