Lineage for d3fruf1 (3fru F:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8450Protein Fc (IgG) receptor, alpha-3 domain and beta subunit [48943] (1 species)
  7. 8451Species Rat (Rattus norvegicus) [TaxId:10116] [48944] (3 PDB entries)
  8. 8457Domain d3fruf1: 3fru F: [20662]
    Other proteins in same PDB: d3frua2, d3fruc2, d3frue2

Details for d3fruf1

PDB Entry: 3fru (more details), 2.2 Å

PDB Description: neonatal fc receptor, ph 6.5

SCOP Domain Sequences for d3fruf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fruf1 b.1.1.2 (F:) Fc (IgG) receptor, alpha-3 domain and beta subunit {Rat (Rattus norvegicus)}
iqktpqiqvysrhppengkpnflncyvsqfhppqieiellkngkkipniemsdlsfskdw
sfyilahteftptetdvyacrvkhvtlkepktvtwdrdm

SCOP Domain Coordinates for d3fruf1:

Click to download the PDB-style file with coordinates for d3fruf1.
(The format of our PDB-style files is described here.)

Timeline for d3fruf1: