Lineage for d3fruf1 (3fru F:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) 
Protein Fc (IgG) receptor, alpha-3 domain and beta subunit [48943] (1 species) Species Rat (Rattus norvegicus) [TaxId:10116] [48944] (3 PDB entries) 
Domain d3fruf1: 3fru F: [20662]
Other proteins in same PDB: d3frua2, d3fruc2, d3frue2
Details for d3fruf1
PDB Entry: 3fru (more details), 2.2 Å
PDB Description: neonatal fc receptor, ph 6.5
SCOP Domain Sequences for d3fruf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fruf1 b.1.1.2 (F:) Fc (IgG) receptor, alpha-3 domain and beta subunit {Rat (Rattus norvegicus)}
iqktpqiqvysrhppengkpnflncyvsqfhppqieiellkngkkipniemsdlsfskdw
sfyilahteftptetdvyacrvkhvtlkepktvtwdrdm
SCOP Domain Coordinates for d3fruf1:
Click to download the PDB-style file with coordinates for d3fruf1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3fruf1:
- d3fruf1 appears in SCOP 1.57
- d3fruf1 appears in the current release, SCOPe 2.08, called d3fruf_
View in 3D
