Lineage for d3fruf_ (3fru F:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2745638Protein beta2-microglobulin [88600] (7 species)
  7. 2746754Species Norway rat (Rattus norvegicus) [TaxId:10116] [88601] (6 PDB entries)
  8. 2746758Domain d3fruf_: 3fru F: [20662]
    Other proteins in same PDB: d3frua1, d3frua2, d3fruc1, d3fruc2, d3frue1, d3frue2
    complexed with bme, nag, so4

Details for d3fruf_

PDB Entry: 3fru (more details), 2.2 Å

PDB Description: neonatal fc receptor, ph 6.5
PDB Compounds: (F:) Beta-2-microglobulin

SCOPe Domain Sequences for d3fruf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fruf_ b.1.1.2 (F:) beta2-microglobulin {Norway rat (Rattus norvegicus) [TaxId: 10116]}
iqktpqiqvysrhppengkpnflncyvsqfhppqieiellkngkkipniemsdlsfskdw
sfyilahteftptetdvyacrvkhvtlkepktvtwdrdm

SCOPe Domain Coordinates for d3fruf_:

Click to download the PDB-style file with coordinates for d3fruf_.
(The format of our PDB-style files is described here.)

Timeline for d3fruf_: