Lineage for d2w41b2 (2w41 B:255-501)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2884835Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2884836Protein automated matches [226839] (64 species)
    not a true protein
  7. 2885406Species Plasmodium falciparum [TaxId:36329] [225582] (23 PDB entries)
  8. 2885455Domain d2w41b2: 2w41 B:255-501 [206616]
    Other proteins in same PDB: d2w41a3, d2w41b3
    automated match to d3ezwd2
    complexed with adp, edo

Details for d2w41b2

PDB Entry: 2w41 (more details), 2.41 Å

PDB Description: crystal structure of plasmodium falciparum glycerol kinase with adp
PDB Compounds: (B:) glycerol kinase, putative

SCOPe Domain Sequences for d2w41b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w41b2 c.55.1.0 (B:255-501) automated matches {Plasmodium falciparum [TaxId: 36329]}
aifdegeakctygtgvfllintgekvvystcglitticykfndndkpkyalegsigtags
gvswllknkliddpseasdimekcenttgvifvpafsglyaprwrsdarasiygmtfnte
rshivrallegiafqlneivdsltsdmgiemlhvlrcdggmtknkpfmqfnsdiintkie
vskykevtslgaavlaglevkiwdsldsvksllrrsdavfhskmddkkrkkktsewnkav
ertliql

SCOPe Domain Coordinates for d2w41b2:

Click to download the PDB-style file with coordinates for d2w41b2.
(The format of our PDB-style files is described here.)

Timeline for d2w41b2: