SCOPe 2.03: Domain d2w41a2: 2w41 A:255-501

Lineage for d2w41a2 (2w41 A:255-501)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (35 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [225582] (2 PDB entries)

8. Domain d2w41a2: 2w41 A:255-501 [206614]
   automated match to d3ezwd2
   complexed with adp, edo

Details for d2w41a2

PDB Entry: 2w41, 2.41 Å

PDB Description: crystal structure of plasmodium falciparum glycerol kinase with adp

PDB Compounds: (A:) glycerol kinase, putative

SCOPe Domain Sequences for d2w41a2:

Sequence; same for both SEQRES and ATOM records:

>d2w41a2 c.55.1.0 (A:255-501) automated matches {Plasmodium falciparum [TaxId: 36329]}
aifdegeakctygtgvfllintgekvvystcglitticykfndndkpkyalegsigtags
gvswllknkliddpseasdimekcenttgvifvpafsglyaprwrsdarasiygmtfnte
rshivrallegiafqlneivdsltsdmgiemlhvlrcdggmtknkpfmqfnsdiintkie
vskykevtslgaavlaglevkiwdsldsvksllrrsdavfhskmddkkrkkktsewnkav
ertliql

Timeline for d2w41a2:

• d2w41a2 is new in SCOPe 2.03-stable
  
• d2w41a2 appears in SCOPe 2.04
  
• d2w41a2 appears in the current release, SCOPe 2.08