| Class b: All beta proteins [48724] (119 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
| Protein Fc (IgG) receptor, alpha-3 domain and beta subunit [48943] (1 species) |
| Species Rat (Rattus norvegicus) [TaxId:10116] [48944] (3 PDB entries) |
| Domain d3frue1: 3fru E:179-269 [20661] Other proteins in same PDB: d3frua2, d3fruc2, d3frue2 complexed with bme, fuc, gal, man, nag, so4 |
PDB Entry: 3fru (more details), 2.2 Å
SCOP Domain Sequences for d3frue1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3frue1 b.1.1.2 (E:179-269) Fc (IgG) receptor, alpha-3 domain and beta subunit {Rat (Rattus norvegicus)}
keppsmrlkarpgnsgssvltcaafsfyppelkfrflrnglasgsgncstgpngdgsfha
wsllevkrgdehhyqcqveheglaqpltvdl
Timeline for d3frue1: