SCOP 1.63: Domain d3frue1: 3fru E:179-269

Lineage for d3frue1 (3fru E:179-269)

Root: SCOP 1.63
Class b: All beta proteins [48724] (119 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
Protein Fc (IgG) receptor, alpha-3 domain and beta subunit [48943] (1 species)
Species Rat (Rattus norvegicus) [TaxId:10116] [48944] (3 PDB entries)
Domain d3frue1: 3fru E:179-269 [20661]
Other proteins in same PDB: d3frua2, d3fruc2, d3frue2
complexed with bme, fuc, gal, man, nag, so4

Details for d3frue1

PDB Entry: 3fru (more details), 2.2 Å

PDB Description: neonatal fc receptor, ph 6.5

SCOP Domain Sequences for d3frue1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3frue1 b.1.1.2 (E:179-269) Fc (IgG) receptor, alpha-3 domain and beta subunit {Rat (Rattus norvegicus)}
keppsmrlkarpgnsgssvltcaafsfyppelkfrflrnglasgsgncstgpngdgsfha
wsllevkrgdehhyqcqveheglaqpltvdl

SCOP Domain Coordinates for d3frue1:

Click to download the PDB-style file with coordinates for d3frue1.
(The format of our PDB-style files is described here.)

Timeline for d3frue1: