![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.167: Peptide deformylase [56419] (1 superfamily) alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix |
![]() | Superfamily d.167.1: Peptide deformylase [56420] (2 families) ![]() nickel-dependent enzyme |
![]() | Family d.167.1.0: automated matches [191587] (1 protein) not a true family |
![]() | Protein automated matches [191055] (20 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [226789] (2 PDB entries) |
![]() | Domain d2w3ua_: 2w3u A: [206604] automated match to d3qu1a_ complexed with fmt, ni |
PDB Entry: 2w3u (more details), 1.96 Å
SCOPe Domain Sequences for d2w3ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w3ua_ d.167.1.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]} svlqvlhipderlrkvakpveevnaeiqrivddmfetmyaeegiglaatqvdihqriivi dvsenrderlvlinpelleksgetgieegclsipeqralvpraekvkiraldrdgkpfel eadgllaiciqhemdhlvgklfmdylsplkqqrirqkvekldrlk
Timeline for d2w3ua_: