| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.167: Peptide deformylase [56419] (1 superfamily) alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix |
Superfamily d.167.1: Peptide deformylase [56420] (2 families) ![]() nickel-dependent enzyme |
| Family d.167.1.0: automated matches [191587] (1 protein) not a true family |
| Protein automated matches [191055] (9 species) not a true protein |
| Species Escherichia coli [TaxId:83333] [226789] (2 PDB entries) |
| Domain d2w3ta_: 2w3t A: [206603] automated match to d3qu1a_ complexed with cl, eoh, ni |
PDB Entry: 2w3t (more details), 1.69 Å
SCOPe Domain Sequences for d2w3ta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w3ta_ d.167.1.0 (A:) automated matches {Escherichia coli [TaxId: 83333]}
svlqvlhipderlrkvakpveevnaeiqrivddmfetmyaeegiglaatqvdihqriivi
dvsenrderlvlinpelleksgetgieegclsipeqralvpraekvkiraldrdgkpfel
eadgllaiciqhemdhlvgklfmdylsplkqqrirqkvekldrlkar
Timeline for d2w3ta_: