Lineage for d2w3ta_ (2w3t A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3000942Fold d.167: Peptide deformylase [56419] (1 superfamily)
    alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix
  4. 3000943Superfamily d.167.1: Peptide deformylase [56420] (2 families) (S)
    nickel-dependent enzyme
  5. 3001128Family d.167.1.0: automated matches [191587] (1 protein)
    not a true family
  6. 3001129Protein automated matches [191055] (20 species)
    not a true protein
  7. 3001165Species Escherichia coli K-12 [TaxId:83333] [226789] (2 PDB entries)
  8. 3001166Domain d2w3ta_: 2w3t A: [206603]
    automated match to d3qu1a_
    complexed with cl, eoh, ni

Details for d2w3ta_

PDB Entry: 2w3t (more details), 1.69 Å

PDB Description: chloro complex of the ni-form of e.coli deformylase
PDB Compounds: (A:) Peptide deformylase

SCOPe Domain Sequences for d2w3ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w3ta_ d.167.1.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
svlqvlhipderlrkvakpveevnaeiqrivddmfetmyaeegiglaatqvdihqriivi
dvsenrderlvlinpelleksgetgieegclsipeqralvpraekvkiraldrdgkpfel
eadgllaiciqhemdhlvgklfmdylsplkqqrirqkvekldrlkar

SCOPe Domain Coordinates for d2w3ta_:

Click to download the PDB-style file with coordinates for d2w3ta_.
(The format of our PDB-style files is described here.)

Timeline for d2w3ta_: