SCOPe 2.08: Domain d2w3sf1: 2w3s F:2-123

Lineage for d2w3sf1 (2w3s F:2-123)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
   core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids

4. Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (2 families)

5. Family d.41.1.1: CO dehydrogenase molybdoprotein N-domain-like [54666] (6 proteins)

6. Protein Xanthine dehydrogenase chain B, N-terminal domain [69691] (1 species)

7. Species Rhodobacter capsulatus [TaxId:1061] [69692] (4 PDB entries)

8. Domain d2w3sf1: 2w3s F:2-123 [206599]
   Other proteins in same PDB: d2w3sa1, d2w3sa2, d2w3sa3, d2w3sa4, d2w3sb2, d2w3sc1, d2w3sc2, d2w3sc3, d2w3sc4, d2w3sd2, d2w3se1, d2w3se2, d2w3se3, d2w3se4, d2w3sf2, d2w3sg1, d2w3sg2, d2w3sg3, d2w3sg4, d2w3sh2
   automated match to d1jrob1
   complexed with ca, fad, fes, mom, mte, xan

Details for d2w3sf1

PDB Entry: 2w3s, 2.6 Å

PDB Description: crystal structure of xanthine dehydrogenase (desulfo form) from rhodobacter capsulatus in complex with xanthine

PDB Compounds: (F:) Xanthine Dehydrogenase

SCOPe Domain Sequences for d2w3sf1:

Sequence; same for both SEQRES and ATOM records:

>d2w3sf1 d.41.1.1 (F:2-123) Xanthine dehydrogenase chain B, N-terminal domain {Rhodobacter capsulatus [TaxId: 1061]}
svgkplphdsarahvtgqarylddlpcpantlhlafglsteasaaitgldlepvrespgv
iavftaadlphdndaspapspepvlatgevhfvgqpiflvaatshraariaarkaritya
pr

Timeline for d2w3sf1:

• d2w3sf1 first appeared in SCOPe 2.03
  
• d2w3sf1 appears in SCOPe 2.07