Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies) core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids |
Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (2 families) |
Family d.41.1.1: CO dehydrogenase molybdoprotein N-domain-like [54666] (6 proteins) |
Protein Xanthine dehydrogenase chain B, N-terminal domain [69691] (1 species) |
Species Rhodobacter capsulatus [TaxId:1061] [69692] (4 PDB entries) |
Domain d2w3sd1: 2w3s D:2-123 [206597] Other proteins in same PDB: d2w3sa1, d2w3sa2, d2w3sa3, d2w3sa4, d2w3sb2, d2w3sc1, d2w3sc2, d2w3sc3, d2w3sc4, d2w3sd2, d2w3se1, d2w3se2, d2w3se3, d2w3se4, d2w3sf2, d2w3sg1, d2w3sg2, d2w3sg3, d2w3sg4, d2w3sh2 automated match to d1jrob1 complexed with ca, fad, fes, mom, mte, xan |
PDB Entry: 2w3s (more details), 2.6 Å
SCOPe Domain Sequences for d2w3sd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w3sd1 d.41.1.1 (D:2-123) Xanthine dehydrogenase chain B, N-terminal domain {Rhodobacter capsulatus [TaxId: 1061]} svgkplphdsarahvtgqarylddlpcpantlhlafglsteasaaitgldlepvrespgv iavftaadlphdndaspapspepvlatgevhfvgqpiflvaatshraariaarkaritya pr
Timeline for d2w3sd1: