Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Fc (IgG) receptor, alpha-3 domain [88612] (2 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [88613] (3 PDB entries) |
Domain d3fruc1: 3fru C:179-269 [20659] Other proteins in same PDB: d3frua2, d3frub_, d3fruc2, d3frud_, d3frue2, d3fruf_ complexed with bme, nag, so4 |
PDB Entry: 3fru (more details), 2.2 Å
SCOPe Domain Sequences for d3fruc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fruc1 b.1.1.2 (C:179-269) Fc (IgG) receptor, alpha-3 domain {Norway rat (Rattus norvegicus) [TaxId: 10116]} keppsmrlkarpgnsgssvltcaafsfyppelkfrflrnglasgsgncstgpngdgsfha wsllevkrgdehhyqcqveheglaqpltvdl
Timeline for d3fruc1: