Lineage for d3fruc1 (3fru C:179-269)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1105902Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1107309Protein Fc (IgG) receptor, alpha-3 domain [88612] (2 species)
  7. 1107312Species Norway rat (Rattus norvegicus) [TaxId:10116] [88613] (3 PDB entries)
  8. 1107314Domain d3fruc1: 3fru C:179-269 [20659]
    Other proteins in same PDB: d3frua2, d3frub_, d3fruc2, d3frud_, d3frue2, d3fruf_
    complexed with bme, nag, so4

Details for d3fruc1

PDB Entry: 3fru (more details), 2.2 Å

PDB Description: neonatal fc receptor, ph 6.5
PDB Compounds: (C:) neonatal fc receptor

SCOPe Domain Sequences for d3fruc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fruc1 b.1.1.2 (C:179-269) Fc (IgG) receptor, alpha-3 domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
keppsmrlkarpgnsgssvltcaafsfyppelkfrflrnglasgsgncstgpngdgsfha
wsllevkrgdehhyqcqveheglaqpltvdl

SCOPe Domain Coordinates for d3fruc1:

Click to download the PDB-style file with coordinates for d3fruc1.
(The format of our PDB-style files is described here.)

Timeline for d3fruc1: