SCOP 1.63: Domain d3fruc1: 3fru C:179-269

Lineage for d3fruc1 (3fru C:179-269)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Fc (IgG) receptor, alpha-3 domain and beta subunit [48943] (1 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [48944] (3 PDB entries)

8. Domain d3fruc1: 3fru C:179-269 [20659]
   Other proteins in same PDB: d3frua2, d3fruc2, d3frue2

Details for d3fruc1

PDB Entry: 3fru, 2.2 Å

PDB Description: neonatal fc receptor, ph 6.5

SCOP Domain Sequences for d3fruc1:

Sequence; same for both SEQRES and ATOM records:

>d3fruc1 b.1.1.2 (C:179-269) Fc (IgG) receptor, alpha-3 domain and beta subunit {Rat (Rattus norvegicus)}
keppsmrlkarpgnsgssvltcaafsfyppelkfrflrnglasgsgncstgpngdgsfha
wsllevkrgdehhyqcqveheglaqpltvdl

Timeline for d3fruc1:

• d3fruc1 first appeared (with stable ids) in SCOP 1.55
  
• d3fruc1 appears in SCOP 1.61
  
• d3fruc1 appears in SCOP 1.65
  
• d3fruc1 appears in the current release, SCOPe 2.08