Lineage for d3fruc1 (3fru C:179-269)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220869Protein Fc (IgG) receptor, alpha-3 domain and beta subunit [48943] (1 species)
  7. 220870Species Rat (Rattus norvegicus) [TaxId:10116] [48944] (3 PDB entries)
  8. 220873Domain d3fruc1: 3fru C:179-269 [20659]
    Other proteins in same PDB: d3frua2, d3fruc2, d3frue2

Details for d3fruc1

PDB Entry: 3fru (more details), 2.2 Å

PDB Description: neonatal fc receptor, ph 6.5

SCOP Domain Sequences for d3fruc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fruc1 b.1.1.2 (C:179-269) Fc (IgG) receptor, alpha-3 domain and beta subunit {Rat (Rattus norvegicus)}
keppsmrlkarpgnsgssvltcaafsfyppelkfrflrnglasgsgncstgpngdgsfha
wsllevkrgdehhyqcqveheglaqpltvdl

SCOP Domain Coordinates for d3fruc1:

Click to download the PDB-style file with coordinates for d3fruc1.
(The format of our PDB-style files is described here.)

Timeline for d3fruc1: