Lineage for d2w3rb1 (2w3r B:2-123)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1410866Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 1410867Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (2 families) (S)
  5. 1410868Family d.41.1.1: CO dehydrogenase molybdoprotein N-domain-like [54666] (6 proteins)
  6. 1410909Protein Xanthine dehydrogenase chain B, N-terminal domain [69691] (1 species)
  7. 1410910Species Rhodobacter capsulatus [TaxId:1061] [69692] (4 PDB entries)
  8. 1410919Domain d2w3rb1: 2w3r B:2-123 [206587]
    Other proteins in same PDB: d2w3rb2, d2w3rd2, d2w3rf2, d2w3rh2
    automated match to d1jrob1
    complexed with ca, fad, fes, hpa, mom, mpn

Details for d2w3rb1

PDB Entry: 2w3r (more details), 2.9 Å

PDB Description: crystal structure of xanthine dehydrogenase (desulfo form) from rhodobacter capsulatus in complex with hypoxanthine
PDB Compounds: (B:) Xanthine Dehydrogenase

SCOPe Domain Sequences for d2w3rb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w3rb1 d.41.1.1 (B:2-123) Xanthine dehydrogenase chain B, N-terminal domain {Rhodobacter capsulatus [TaxId: 1061]}
svgkplphdsarahvtgqarylddlpcpantlhlafglsteasaaitgldlepvrespgv
iavftaadlphdndaspapspepvlatgevhfvgqpiflvaatshraariaarkaritya
pr

SCOPe Domain Coordinates for d2w3rb1:

Click to download the PDB-style file with coordinates for d2w3rb1.
(The format of our PDB-style files is described here.)

Timeline for d2w3rb1: