SCOPe 2.03: Domain d2w37a1: 2w37 A:3-156

Lineage for d2w37a1 (2w37 A:3-156)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families)

5. Family c.78.1.0: automated matches [227206] (1 protein)
   not a true family

6. Protein automated matches [226938] (20 species)
   not a true protein

7. Species Lactobacillus hilgardii [TaxId:1588] [225787] (1 PDB entry)

8. Domain d2w37a1: 2w37 A:3-156 [206581]
   automated match to d1dxha1
   complexed with ni

Details for d2w37a1

PDB Entry: 2w37, 2.1 Å

PDB Description: crystal structure of the hexameric catabolic ornithine transcarbamylase from lactobacillus hilgardii

PDB Compounds: (A:) ornithine carbamoyltransferase, catabolic

SCOPe Domain Sequences for d2w37a1:

Sequence; same for both SEQRES and ATOM records:

>d2w37a1 c.78.1.0 (A:3-156) automated matches {Lactobacillus hilgardii [TaxId: 1588]}
kdfrqnvfqgrsvlaekdfsaaeleylidfglhlkalkkagiphhylegkniallfekss
trtrsafttasidlgahpeylgqndiqlgkkestsdtakvlgsmfdgiefrgfkqsdaei
lardsgvpvwngltdewhptqmladfmtvkenfg

Timeline for d2w37a1:

• d2w37a1 is new in SCOPe 2.03-stable
  
• d2w37a1 appears in SCOPe 2.04
  
• d2w37a1 appears in the current release, SCOPe 2.08