Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) |
Family d.92.1.0: automated matches [191495] (1 protein) not a true family |
Protein automated matches [190805] (8 species) not a true protein |
Species Clostridium botulinum [TaxId:1491] [193827] (5 PDB entries) |
Domain d2w2db1: 2w2d B:449-547 [206575] automated match to d3btaa3 complexed with act, cl, gol, so4, zn |
PDB Entry: 2w2d (more details), 2.59 Å
SCOPe Domain Sequences for d2w2db1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w2db1 d.92.1.0 (B:449-547) automated matches {Clostridium botulinum [TaxId: 1491]} alnlqcikvnnwdlffspsednftndlnkgeeitsdtnieaaeenisldliqqyyltfnf dnepenisienlssdiigqlelmpnierfpngkkyeldk
Timeline for d2w2db1: