![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) ![]() |
![]() | Family d.92.1.0: automated matches [191495] (1 protein) not a true family |
![]() | Protein automated matches [190805] (20 species) not a true protein |
![]() | Species Clostridium botulinum [TaxId:1491] [193827] (10 PDB entries) |
![]() | Domain d2w2db1: 2w2d B:454-547 [206575] Other proteins in same PDB: d2w2db2, d2w2db3, d2w2dd2, d2w2dd3 automated match to d3btaa3 complexed with act, cl, gol, so4, zn |
PDB Entry: 2w2d (more details), 2.59 Å
SCOPe Domain Sequences for d2w2db1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w2db1 d.92.1.0 (B:454-547) automated matches {Clostridium botulinum [TaxId: 1491]} cikvnnwdlffspsednftndlnkgeeitsdtnieaaeenisldliqqyyltfnfdnepe nisienlssdiigqlelmpnierfpngkkyeldk
Timeline for d2w2db1: