Lineage for d2w2db1 (2w2d B:454-547)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2964873Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. 2964874Protein automated matches [190805] (20 species)
    not a true protein
  7. 2964881Species Clostridium botulinum [TaxId:1491] [193827] (10 PDB entries)
  8. 2964889Domain d2w2db1: 2w2d B:454-547 [206575]
    Other proteins in same PDB: d2w2db2, d2w2db3, d2w2dd2, d2w2dd3
    automated match to d3btaa3
    complexed with act, cl, gol, so4, zn

Details for d2w2db1

PDB Entry: 2w2d (more details), 2.59 Å

PDB Description: crystal structure of a catalytically active, non-toxic endopeptidase derivative of clostridium botulinum toxin a
PDB Compounds: (B:) botulinum neurotoxin a heavy chain

SCOPe Domain Sequences for d2w2db1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w2db1 d.92.1.0 (B:454-547) automated matches {Clostridium botulinum [TaxId: 1491]}
cikvnnwdlffspsednftndlnkgeeitsdtnieaaeenisldliqqyyltfnfdnepe
nisienlssdiigqlelmpnierfpngkkyeldk

SCOPe Domain Coordinates for d2w2db1:

Click to download the PDB-style file with coordinates for d2w2db1.
(The format of our PDB-style files is described here.)

Timeline for d2w2db1: