SCOPe 2.07: Domain d2w2bb_: 2w2b B:

Lineage for d2w2bb_ (2w2b B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.6: Phenolic acid decarboxylase (PAD) [141469] (2 proteins)
   Pfam PF05870; dimeric enzyme made of lipocalin-like subunits

6. Protein automated matches [226940] (3 species)
   not a true protein

7. Species Lactobacillus plantarum [TaxId:1590] [225786] (3 PDB entries)

8. Domain d2w2bb_: 2w2b B: [206574]
   automated match to d2wsja_
   complexed with act, ipa; mutant

Details for d2w2bb_

PDB Entry: 2w2b, 1.4 Å

PDB Description: crystal structure of single point mutant tyr20phe p-coumaric acid decarboxylase from lactobacillus plantarum: structural insights into the active site and decarboxylation catalytic mechanism

PDB Compounds: (B:) p-coumaric acid decarboxylase

SCOPe Domain Sequences for d2w2bb_:

Sequence; same for both SEQRES and ATOM records:

>d2w2bb_ b.60.1.6 (B:) automated matches {Lactobacillus plantarum [TaxId: 1590]}
tktfktlddflgthfiytfdngweyewyakndhtvdyrihggmvagrwvtdqkadivmlt
egiykiswteptgtdvaldfmpnekklhgtiffpkwveehpeitvtyqnehidlmeqsre
kyatypklvvpefanitymgdagqnnedviseapykempndirngkyfdqnyhrlnk

Timeline for d2w2bb_:

• d2w2bb_ first appeared in SCOPe 2.03
  
• d2w2bb_ appears in SCOPe 2.06
  
• d2w2bb_ appears in the current release, SCOPe 2.08