![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
![]() | Superfamily b.60.1: Lipocalins [50814] (10 families) ![]() bind hydrophobic ligands in their interior |
![]() | Family b.60.1.6: Phenolic acid decarboxylase (PAD) [141469] (2 proteins) Pfam PF05870; dimeric enzyme made of lipocalin-like subunits |
![]() | Protein automated matches [226940] (3 species) not a true protein |
![]() | Species Lactobacillus plantarum [TaxId:1590] [225786] (3 PDB entries) |
![]() | Domain d2w2ab_: 2w2a B: [206572] automated match to d2wsja_ |
PDB Entry: 2w2a (more details), 1.38 Å
SCOPe Domain Sequences for d2w2ab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w2ab_ b.60.1.6 (B:) automated matches {Lactobacillus plantarum [TaxId: 1590]} tktfktlddflgthfiytydngweyewyakndhtvdyrihggmvagrwvtdqkadivmlt egiykiswteptgtdvaldfmpnekklhgtiffpkwveehpeitvtyqnehidlmeqsre kyatypklvvpefanitymgdagqnnedviseapykempndirngkyfdqnyhrl
Timeline for d2w2ab_: