Lineage for d2w2ab_ (2w2a B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2805513Family b.60.1.6: Phenolic acid decarboxylase (PAD) [141469] (2 proteins)
    Pfam PF05870; dimeric enzyme made of lipocalin-like subunits
  6. 2805520Protein automated matches [226940] (3 species)
    not a true protein
  7. 2805529Species Lactobacillus plantarum [TaxId:1590] [225786] (3 PDB entries)
  8. 2805531Domain d2w2ab_: 2w2a B: [206572]
    automated match to d2wsja_

Details for d2w2ab_

PDB Entry: 2w2a (more details), 1.38 Å

PDB Description: crystal structure of p-coumaric acid decarboxylase from lactobacillus plantarum: structural insights into the active site and decarboxylation catalytic mechanism
PDB Compounds: (B:) p-coumaric acid decarboxylase

SCOPe Domain Sequences for d2w2ab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w2ab_ b.60.1.6 (B:) automated matches {Lactobacillus plantarum [TaxId: 1590]}
tktfktlddflgthfiytydngweyewyakndhtvdyrihggmvagrwvtdqkadivmlt
egiykiswteptgtdvaldfmpnekklhgtiffpkwveehpeitvtyqnehidlmeqsre
kyatypklvvpefanitymgdagqnnedviseapykempndirngkyfdqnyhrl

SCOPe Domain Coordinates for d2w2ab_:

Click to download the PDB-style file with coordinates for d2w2ab_.
(The format of our PDB-style files is described here.)

Timeline for d2w2ab_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2w2aa_