Lineage for d3frua1 (3fru A:179-269)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 289052Protein Fc (IgG) receptor, alpha-3 domain [88612] (2 species)
  7. 289055Species Rat (Rattus norvegicus) [TaxId:10116] [88613] (3 PDB entries)
  8. 289056Domain d3frua1: 3fru A:179-269 [20657]
    Other proteins in same PDB: d3frua2, d3frub_, d3fruc2, d3frud_, d3frue2, d3fruf_

Details for d3frua1

PDB Entry: 3fru (more details), 2.2 Å

PDB Description: neonatal fc receptor, ph 6.5

SCOP Domain Sequences for d3frua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3frua1 b.1.1.2 (A:179-269) Fc (IgG) receptor, alpha-3 domain {Rat (Rattus norvegicus)}
keppsmrlkarpgnsgssvltcaafsfyppelkfrflrnglasgsgncstgpngdgsfha
wsllevkrgdehhyqcqveheglaqpltvdl

SCOP Domain Coordinates for d3frua1:

Click to download the PDB-style file with coordinates for d3frua1.
(The format of our PDB-style files is described here.)

Timeline for d3frua1: