Lineage for d3frua1 (3fru A:179-269)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 103279Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 103638Protein Fc (IgG) receptor, alpha-3 domain and beta subunit [48943] (1 species)
  7. 103639Species Rat (Rattus norvegicus) [TaxId:10116] [48944] (3 PDB entries)
  8. 103640Domain d3frua1: 3fru A:179-269 [20657]
    Other proteins in same PDB: d3frua2, d3fruc2, d3frue2

Details for d3frua1

PDB Entry: 3fru (more details), 2.2 Å

PDB Description: neonatal fc receptor, ph 6.5

SCOP Domain Sequences for d3frua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3frua1 b.1.1.2 (A:179-269) Fc (IgG) receptor, alpha-3 domain and beta subunit {Rat (Rattus norvegicus)}
keppsmrlkarpgnsgssvltcaafsfyppelkfrflrnglasgsgncstgpngdgsfha
wsllevkrgdehhyqcqveheglaqpltvdl

SCOP Domain Coordinates for d3frua1:

Click to download the PDB-style file with coordinates for d3frua1.
(The format of our PDB-style files is described here.)

Timeline for d3frua1: