![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.33: EAL domain-like [141868] (1 family) ![]() variant of the beta/alpha-barrel fold with strand 1 being antiparallel to the rest automatically mapped to Pfam PF00563 |
![]() | Family c.1.33.1: EAL domain [141869] (1 protein) Pfam PF00563 |
![]() | Protein Hypothetical protein YkuI, N-terminal domain [141870] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [141871] (2 PDB entries) Uniprot O35014 2-262 |
![]() | Domain d2w27b1: 2w27 B:1-262 [206569] Other proteins in same PDB: d2w27a2, d2w27b2 automated match to d2basa1 complexed with 5gp, ca |
PDB Entry: 2w27 (more details), 2.8 Å
SCOPe Domain Sequences for d2w27b1:
Sequence, based on SEQRES records: (download)
>d2w27b1 c.1.33.1 (B:1-262) Hypothetical protein YkuI, N-terminal domain {Bacillus subtilis [TaxId: 1423]} mldpldiltniddvlpyyqaifsaeeqkvvgyevlgriladseiqslgpffldagipeey klevdnriirqaldrfleadsdllifmnqdanllmldhgesflellkeyeakgielhrfv leitehnfegdieqlyhmlayyrtygikiavdnigkessnldriallspdllkidlqalk vsqpspsyehvlysisllarkigaallyedieanfqlqyawrnggryfqgyylvspsetf lerdvlkqrlktefhqfithek
>d2w27b1 c.1.33.1 (B:1-262) Hypothetical protein YkuI, N-terminal domain {Bacillus subtilis [TaxId: 1423]} mldpldiltniddvlpyyqaifsaeeqkvvgyevlgriladseiqslgpffldagipeey klevdnriirqaldrfleadsdllifmnqdanllmldhgesflellkeyeakgielhrfv leitehnfegdieqlyhmlayyrtygikiavdnigkessnldriallspdllkidlqalk spsyehvlysisllarkigaallyedieanfqlqyawrnggryfqgyylvspsetflerd vlkqrlktefhqfithek
Timeline for d2w27b1: