SCOPe 2.08: Domain d2w27b1: 2w27 B:1-262

Lineage for d2w27b1 (2w27 B:1-262)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.33: EAL domain-like [141868] (1 family)
   variant of the beta/alpha-barrel fold with strand 1 being antiparallel to the rest
   automatically mapped to Pfam PF00563

5. Family c.1.33.1: EAL domain [141869] (1 protein)
   Pfam PF00563

6. Protein Hypothetical protein YkuI, N-terminal domain [141870] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [141871] (2 PDB entries)
   Uniprot O35014 2-262

8. Domain d2w27b1: 2w27 B:1-262 [206569]
   Other proteins in same PDB: d2w27a2, d2w27b2
   automated match to d2basa1
   complexed with 5gp, ca

Details for d2w27b1

PDB Entry: 2w27, 2.8 Å

PDB Description: crystal structure of the bacillus subtilis ykui protein, with an eal domain, in complex with substrate c-di-gmp and calcium

PDB Compounds: (B:) YkuI protein

SCOPe Domain Sequences for d2w27b1:

Sequence, based on SEQRES records:

>d2w27b1 c.1.33.1 (B:1-262) Hypothetical protein YkuI, N-terminal domain {Bacillus subtilis [TaxId: 1423]}
mldpldiltniddvlpyyqaifsaeeqkvvgyevlgriladseiqslgpffldagipeey
klevdnriirqaldrfleadsdllifmnqdanllmldhgesflellkeyeakgielhrfv
leitehnfegdieqlyhmlayyrtygikiavdnigkessnldriallspdllkidlqalk
vsqpspsyehvlysisllarkigaallyedieanfqlqyawrnggryfqgyylvspsetf
lerdvlkqrlktefhqfithek

Sequence, based on observed residues (ATOM records):

>d2w27b1 c.1.33.1 (B:1-262) Hypothetical protein YkuI, N-terminal domain {Bacillus subtilis [TaxId: 1423]}
mldpldiltniddvlpyyqaifsaeeqkvvgyevlgriladseiqslgpffldagipeey
klevdnriirqaldrfleadsdllifmnqdanllmldhgesflellkeyeakgielhrfv
leitehnfegdieqlyhmlayyrtygikiavdnigkessnldriallspdllkidlqalk
spsyehvlysisllarkigaallyedieanfqlqyawrnggryfqgyylvspsetflerd
vlkqrlktefhqfithek

Timeline for d2w27b1:

• d2w27b1 first appeared in SCOPe 2.03
  
• d2w27b1 appears in SCOPe 2.07