![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.110.6: Sensory domain-like [103190] (5 families) ![]() alpha(2)-beta(2)-alpha(2)-beta(3); possibly related to the PAS domain |
![]() | Family d.110.6.2: YkuI C-terminal domain-like [143732] (2 proteins) PfamB PB021678 |
![]() | Protein Hypothetical protein YkuI, C-terminal domain [143733] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [143734] (2 PDB entries) Uniprot O35014 263-407 |
![]() | Domain d2w27a2: 2w27 A:263-407 [206568] Other proteins in same PDB: d2w27a1, d2w27b1 automated match to d2basa2 complexed with 5gp, ca |
PDB Entry: 2w27 (more details), 2.8 Å
SCOPe Domain Sequences for d2w27a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w27a2 d.110.6.2 (A:263-407) Hypothetical protein YkuI, C-terminal domain {Bacillus subtilis [TaxId: 1423]} kkletvyehseqfykrvhqavtslrknnlssdddfikklaeeltdcsfriymcdeegdql tgnvfkqdgewiyqpeyaeknwswrpyflenimrmrnlrkgffsdlysdletgemirtfs ypmddqmylfidlpysylyeqdgli
Timeline for d2w27a2: