| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.160: Carbon-nitrogen hydrolase [56316] (1 superfamily) 4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication |
Superfamily d.160.1: Carbon-nitrogen hydrolase [56317] (3 families) ![]() Pfam PF00795; some topological similarities to the metallo-dependent phosphatases and DNase I-like nucleases |
| Family d.160.1.0: automated matches [191429] (1 protein) not a true family |
| Protein automated matches [190617] (6 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [225581] (1 PDB entry) |
| Domain d2w1vb_: 2w1v B: [206564] automated match to d3ivza_ |
PDB Entry: 2w1v (more details), 1.49 Å
SCOPe Domain Sequences for d2w1vb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w1vb_ d.160.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mstfrlaliqlqvssiksdnltracslvreaakqganivslpecfnspygttyfpdyaek
ipgestqklsevakessiyliggsipeedagklyntcsvfgpdgsllvkhrkihlfdidv
pgkitfqesktlspgdsfstfdtpyckvglgicydmrfaelaqiyaqrgcqllvypgafn
lttgpahwellqraravdnqvyvatasparddkasyvawghstvvdpwgqvltkagteet
ilysdidlkklaeirqqipilkqkradlytvesk
Timeline for d2w1vb_: