SCOPe 2.08: Domain d2w1vb_: 2w1v B:

Lineage for d2w1vb_ (2w1v B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.160: Carbon-nitrogen hydrolase [56316] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.160.1: Carbon-nitrogen hydrolase [56317] (3 families)
   Pfam PF00795; some topological similarities to the metallo-dependent phosphatases and DNase I-like nucleases

5. Family d.160.1.0: automated matches [191429] (1 protein)
   not a true family

6. Protein automated matches [190617] (6 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [225581] (1 PDB entry)

8. Domain d2w1vb_: 2w1v B: [206564]
   automated match to d3ivza_

Details for d2w1vb_

PDB Entry: 2w1v, 1.49 Å

PDB Description: crystal structure of mouse nitrilase-2 at 1.4a resolution

PDB Compounds: (B:) nitrilase homolog 2

SCOPe Domain Sequences for d2w1vb_:

Sequence; same for both SEQRES and ATOM records:

>d2w1vb_ d.160.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mstfrlaliqlqvssiksdnltracslvreaakqganivslpecfnspygttyfpdyaek
ipgestqklsevakessiyliggsipeedagklyntcsvfgpdgsllvkhrkihlfdidv
pgkitfqesktlspgdsfstfdtpyckvglgicydmrfaelaqiyaqrgcqllvypgafn
lttgpahwellqraravdnqvyvatasparddkasyvawghstvvdpwgqvltkagteet
ilysdidlkklaeirqqipilkqkradlytvesk

Timeline for d2w1vb_:

• d2w1vb_ first appeared in SCOPe 2.03
  
• d2w1vb_ appears in SCOPe 2.07