Lineage for d2w0qb4 (2w0q B:301-726)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2781474Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2781475Superfamily b.30.2: Amine oxidase catalytic domain [49998] (1 family) (S)
    automatically mapped to Pfam PF01179
  5. 2781476Family b.30.2.1: Amine oxidase catalytic domain [49999] (3 proteins)
  6. 2781477Protein Copper amine oxidase, domain 3 [50000] (4 species)
  7. 2781543Species Escherichia coli [TaxId:562] [50001] (16 PDB entries)
  8. 2781557Domain d2w0qb4: 2w0q B:301-726 [206560]
    Other proteins in same PDB: d2w0qa1, d2w0qa2, d2w0qa3, d2w0qb1, d2w0qb2, d2w0qb3
    automated match to d1oacb1
    complexed with ca, cu, xe

Details for d2w0qb4

PDB Entry: 2w0q (more details), 2.48 Å

PDB Description: e. coli copper amine oxidase in complex with xenon
PDB Compounds: (B:) copper amine oxidase

SCOPe Domain Sequences for d2w0qb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w0qb4 b.30.2.1 (B:301-726) Copper amine oxidase, domain 3 {Escherichia coli [TaxId: 562]}
pavkpmqiiepegknytitgdmihwrnwdfhlsmnsrvgpmistvtyndngtkrkvmyeg
slggmivpygdpdigwyfkayldsgdygmgtltspiargkdapsnavllnetiadytgvp
meipraiavferyagpeykhqemgqpnvsterrelvvrwistvgnydyifdwifhengti
gidagatgieavkgvkaktmhdetakddtrygtlidhnivgtthqhiynfrldldvdgen
nslvamdpvvkpntaggprtstmqvnqynigneqdaaqkfdpgtirllsnpnkenrmgnp
vsyqiipyaggthpvakgaqfapdewiyhrlsfmdkqlwvtryhpgerfpegkypnrsth
dtglgqyskdnesldntdavvwmttgtthvaraeewpimptewvhtllkpwnffdetptl
galkkd

SCOPe Domain Coordinates for d2w0qb4:

Click to download the PDB-style file with coordinates for d2w0qb4.
(The format of our PDB-style files is described here.)

Timeline for d2w0qb4: