![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
![]() | Superfamily b.30.2: Amine oxidase catalytic domain [49998] (1 family) ![]() automatically mapped to Pfam PF01179 |
![]() | Family b.30.2.1: Amine oxidase catalytic domain [49999] (3 proteins) |
![]() | Protein Copper amine oxidase, domain 3 [50000] (4 species) |
![]() | Species Escherichia coli [TaxId:562] [50001] (16 PDB entries) |
![]() | Domain d2w0qb4: 2w0q B:301-726 [206560] Other proteins in same PDB: d2w0qa1, d2w0qa2, d2w0qa3, d2w0qb1, d2w0qb2, d2w0qb3 automated match to d1oacb1 complexed with ca, cu, xe |
PDB Entry: 2w0q (more details), 2.48 Å
SCOPe Domain Sequences for d2w0qb4:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w0qb4 b.30.2.1 (B:301-726) Copper amine oxidase, domain 3 {Escherichia coli [TaxId: 562]} pavkpmqiiepegknytitgdmihwrnwdfhlsmnsrvgpmistvtyndngtkrkvmyeg slggmivpygdpdigwyfkayldsgdygmgtltspiargkdapsnavllnetiadytgvp meipraiavferyagpeykhqemgqpnvsterrelvvrwistvgnydyifdwifhengti gidagatgieavkgvkaktmhdetakddtrygtlidhnivgtthqhiynfrldldvdgen nslvamdpvvkpntaggprtstmqvnqynigneqdaaqkfdpgtirllsnpnkenrmgnp vsyqiipyaggthpvakgaqfapdewiyhrlsfmdkqlwvtryhpgerfpegkypnrsth dtglgqyskdnesldntdavvwmttgtthvaraeewpimptewvhtllkpwnffdetptl galkkd
Timeline for d2w0qb4:
![]() Domains from other chains: (mouse over for more information) d2w0qa1, d2w0qa2, d2w0qa3, d2w0qa4 |