Lineage for d2w0qb1 (2w0q B:6-90)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2962266Fold d.82: N domain of copper amine oxidase-like [55382] (5 superfamilies)
    alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet
  4. 2962267Superfamily d.82.1: Copper amine oxidase, domain N [55383] (2 families) (S)
    automatically mapped to Pfam PF07833
  5. 2962268Family d.82.1.1: Copper amine oxidase, domain N [55384] (1 protein)
  6. 2962269Protein Copper amine oxidase, domain N [55385] (1 species)
    non-conserved N-terminal domain
  7. 2962270Species Escherichia coli [TaxId:562] [55386] (16 PDB entries)
  8. 2962284Domain d2w0qb1: 2w0q B:6-90 [206557]
    Other proteins in same PDB: d2w0qa2, d2w0qa3, d2w0qa4, d2w0qb2, d2w0qb3, d2w0qb4
    automated match to d1oacb4
    complexed with ca, cu, xe

Details for d2w0qb1

PDB Entry: 2w0q (more details), 2.48 Å

PDB Description: e. coli copper amine oxidase in complex with xenon
PDB Compounds: (B:) copper amine oxidase

SCOPe Domain Sequences for d2w0qb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w0qb1 d.82.1.1 (B:6-90) Copper amine oxidase, domain N {Escherichia coli [TaxId: 562]}
hmvpmdktlkefgadvqwddyaqlftlikdgayvkvkpgaqtaivngqplalqvpvvmkd
nkawvsdtfindvfqsgldqtfqve

SCOPe Domain Coordinates for d2w0qb1:

Click to download the PDB-style file with coordinates for d2w0qb1.
(The format of our PDB-style files is described here.)

Timeline for d2w0qb1: