Lineage for d2w0qa2 (2w0q A:91-185)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2935960Superfamily d.17.2: Amine oxidase N-terminal region [54416] (2 families) (S)
  5. 2935961Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
    duplication: contains two domains of this fold
  6. 2935962Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)
  7. 2936092Species Escherichia coli [TaxId:562] [54419] (16 PDB entries)
  8. 2936117Domain d2w0qa2: 2w0q A:91-185 [206554]
    Other proteins in same PDB: d2w0qa1, d2w0qa4, d2w0qb1, d2w0qb4
    automated match to d1d6zb2
    complexed with ca, cu, xe

Details for d2w0qa2

PDB Entry: 2w0q (more details), 2.48 Å

PDB Description: e. coli copper amine oxidase in complex with xenon
PDB Compounds: (A:) copper amine oxidase

SCOPe Domain Sequences for d2w0qa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w0qa2 d.17.2.1 (A:91-185) Copper amine oxidase, domains 1 and 2 {Escherichia coli [TaxId: 562]}
krphplnaltadeikqaveivkasadfkpntrfteisllppdkeavwafalenkpvdqpr
kadvimldgkhiieavvdlqnnkllswqpikdahg

SCOPe Domain Coordinates for d2w0qa2:

Click to download the PDB-style file with coordinates for d2w0qa2.
(The format of our PDB-style files is described here.)

Timeline for d2w0qa2: