Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.14: Gated ion channels [81325] (2 superfamilies) oligomeric transmembrane alpha-helical proteins |
Superfamily f.14.1: Voltage-gated ion channels [81324] (5 families) Pfam PF00520 |
Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins) |
Protein automated matches [190184] (3 species) not a true protein |
Species Streptomyces lividans [TaxId:1916] [186922] (11 PDB entries) |
Domain d2w0fc_: 2w0f C: [206552] Other proteins in same PDB: d2w0fa1, d2w0fa2, d2w0fa3, d2w0fb1, d2w0fb2 automated match to d1s5hc_ protein/RNA complex; complexed with co, dga, f09, hx0, k |
PDB Entry: 2w0f (more details), 2.4 Å
SCOPe Domain Sequences for d2w0fc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w0fc_ f.14.1.1 (C:) automated matches {Streptomyces lividans [TaxId: 1916]} alhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdly pvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh
Timeline for d2w0fc_: