Lineage for d2w07a2 (2w07 A:125-216)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2368400Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2368704Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (2 families) (S)
  5. 2368705Family b.7.2.1: Periplasmic chaperone C-domain [49585] (5 proteins)
  6. 2368756Protein PapD [49586] (1 species)
  7. 2368757Species Escherichia coli [TaxId:562] [49587] (15 PDB entries)
  8. 2368764Domain d2w07a2: 2w07 A:125-216 [206547]
    Other proteins in same PDB: d2w07a1
    automated match to d1pdka2
    complexed with so4

Details for d2w07a2

PDB Entry: 2w07 (more details), 2.2 Å

PDB Description: structural determinants of polymerization reactivity of the p pilus adaptor subunit papf
PDB Compounds: (A:) chaperone protein papd

SCOPe Domain Sequences for d2w07a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w07a2 b.7.2.1 (A:125-216) PapD {Escherichia coli [TaxId: 562]}
nevwqdqlilnkvsggyrienptpyyvtviglggsekqaeegefetvmlsprseqtvksa
nyntpylsyindyggrpvlsficngsrcsvkk

SCOPe Domain Coordinates for d2w07a2:

Click to download the PDB-style file with coordinates for d2w07a2.
(The format of our PDB-style files is described here.)

Timeline for d2w07a2: