SCOPe 2.06: Domain d2vyqa2: 2vyq A:140-303

Lineage for d2vyqa2 (2vyq A:140-303)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
   3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families)
   binds NADP differently than classical Rossmann-fold
   N-terminal FAD-linked domain contains (6,10) barrel

5. Family c.25.1.0: automated matches [227163] (1 protein)
   not a true family

6. Protein automated matches [226871] (18 species)
   not a true protein

7. Species Nostoc sp. [TaxId:1168] [225653] (2 PDB entries)

8. Domain d2vyqa2: 2vyq A:140-303 [206539]
   Other proteins in same PDB: d2vyqa1
   automated match to d1frna2
   complexed with fad, gol, so4; mutant

Details for d2vyqa2

PDB Entry: 2vyq, 1.9 Å

PDB Description: ferredoxin:nadp reductase mutant with thr 155 replaced by gly, ala 160 replaced by thr, leu 263 replaced by pro and tyr 303 replaced by ser (t155g-a160t-l263p-y303s)

PDB Compounds: (A:) ferredoxin-nadp reductase

SCOPe Domain Sequences for d2vyqa2:

Sequence; same for both SEQRES and ATOM records:

>d2vyqa2 c.25.1.0 (A:140-303) automated matches {Nostoc sp. [TaxId: 1168]}
mllpddpeanvimlaggtgitpmrtylwrmfkdaeraanpeyqfkgfswlvfgvpttpni
lykeeleeiqqkypdnfrltyaisreqknpqggrmyiqdrvaehadelwqliknqkthty
icgprgmeegidaalsaaaakegvtwsdyqkdlkkagrwhvets

Timeline for d2vyqa2:

• d2vyqa2 first appeared in SCOPe 2.03
  
• d2vyqa2 appears in SCOPe 2.05
  
• d2vyqa2 appears in SCOPe 2.07
  
• d2vyqa2 appears in the current release, SCOPe 2.08