Class b: All beta proteins [48724] (174 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) |
Family b.43.4.0: automated matches [227162] (1 protein) not a true family |
Protein automated matches [226870] (15 species) not a true protein |
Species Nostoc sp. [TaxId:1168] [225652] (2 PDB entries) |
Domain d2vyqa1: 2vyq A:9-139 [206538] Other proteins in same PDB: d2vyqa2 automated match to d1frna1 complexed with fad, gol, so4; mutant |
PDB Entry: 2vyq (more details), 1.9 Å
SCOPe Domain Sequences for d2vyqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vyqa1 b.43.4.0 (A:9-139) automated matches {Nostoc sp. [TaxId: 1168]} dvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqsigiippgvd kngkpeklrlysiastrhgddvddktislcvrqleykhpesgetvygvcstylthiepgs evkitgpvgke
Timeline for d2vyqa1: