SCOPe 2.08: Domain d2vyqa1: 2vyq A:9-139

Lineage for d2vyqa1 (2vyq A:9-139)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families)

5. Family b.43.4.0: automated matches [227162] (1 protein)
   not a true family

6. Protein automated matches [226870] (22 species)
   not a true protein

7. Species Nostoc sp. [TaxId:1168] [225652] (2 PDB entries)

8. Domain d2vyqa1: 2vyq A:9-139 [206538]
   Other proteins in same PDB: d2vyqa2
   automated match to d1frna1
   complexed with fad, gol, so4; mutant

Details for d2vyqa1

PDB Entry: 2vyq, 1.9 Å

PDB Description: ferredoxin:nadp reductase mutant with thr 155 replaced by gly, ala 160 replaced by thr, leu 263 replaced by pro and tyr 303 replaced by ser (t155g-a160t-l263p-y303s)

PDB Compounds: (A:) ferredoxin-nadp reductase

SCOPe Domain Sequences for d2vyqa1:

Sequence; same for both SEQRES and ATOM records:

>d2vyqa1 b.43.4.0 (A:9-139) automated matches {Nostoc sp. [TaxId: 1168]}
dvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqsigiippgvd
kngkpeklrlysiastrhgddvddktislcvrqleykhpesgetvygvcstylthiepgs
evkitgpvgke

Timeline for d2vyqa1:

• d2vyqa1 first appeared in SCOPe 2.03
  
• d2vyqa1 appears in SCOPe 2.07