Lineage for d2vyqa1 (2vyq A:9-139)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2792909Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2793458Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) (S)
  5. 2793672Family b.43.4.0: automated matches [227162] (1 protein)
    not a true family
  6. 2793673Protein automated matches [226870] (22 species)
    not a true protein
  7. 2793762Species Nostoc sp. [TaxId:1168] [225652] (2 PDB entries)
  8. 2793764Domain d2vyqa1: 2vyq A:9-139 [206538]
    Other proteins in same PDB: d2vyqa2
    automated match to d1frna1
    complexed with fad, gol, so4; mutant

Details for d2vyqa1

PDB Entry: 2vyq (more details), 1.9 Å

PDB Description: ferredoxin:nadp reductase mutant with thr 155 replaced by gly, ala 160 replaced by thr, leu 263 replaced by pro and tyr 303 replaced by ser (t155g-a160t-l263p-y303s)
PDB Compounds: (A:) ferredoxin-nadp reductase

SCOPe Domain Sequences for d2vyqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vyqa1 b.43.4.0 (A:9-139) automated matches {Nostoc sp. [TaxId: 1168]}
dvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqsigiippgvd
kngkpeklrlysiastrhgddvddktislcvrqleykhpesgetvygvcstylthiepgs
evkitgpvgke

SCOPe Domain Coordinates for d2vyqa1:

Click to download the PDB-style file with coordinates for d2vyqa1.
(The format of our PDB-style files is described here.)

Timeline for d2vyqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2vyqa2