SCOPe 2.05: Domain d2vypa2: 2vyp A:147-374

Lineage for d2vypa2 (2vyp A:147-374)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein Actin [53073] (7 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (62 PDB entries)
   Uniprot P02568 ! SQ 02568

8. Domain d2vypa2: 2vyp A:147-374 [206535]
   automated match to d1ijja2
   complexed with atp, ca, hez, rh9

Details for d2vypa2

PDB Entry: 2vyp, 2.35 Å

PDB Description: rabbit-muscle g-actin in complex with myxobacterial rhizopodin

PDB Compounds: (A:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d2vypa2:

Sequence; same for both SEQRES and ATOM records:

>d2vypa2 c.55.1.1 (A:147-374) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
rttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvttaer
eivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqpsf
igmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwitkqeydeagpsivhrkc

Timeline for d2vypa2:

• d2vypa2 first appeared in SCOPe 2.03
  
• d2vypa2 appears in SCOPe 2.04
  
• d2vypa2 appears in SCOPe 2.06
  
• d2vypa2 appears in the current release, SCOPe 2.08