Lineage for d2vypa2 (2vyp A:147-374)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1857401Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1857402Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 1857403Protein Actin [53073] (7 species)
  7. 1857429Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (62 PDB entries)
    Uniprot P02568 ! SQ 02568
  8. 1857501Domain d2vypa2: 2vyp A:147-374 [206535]
    automated match to d1ijja2
    complexed with atp, ca, hez, rh9

Details for d2vypa2

PDB Entry: 2vyp (more details), 2.35 Å

PDB Description: rabbit-muscle g-actin in complex with myxobacterial rhizopodin
PDB Compounds: (A:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d2vypa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vypa2 c.55.1.1 (A:147-374) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
rttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvttaer
eivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqpsf
igmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwitkqeydeagpsivhrkc

SCOPe Domain Coordinates for d2vypa2:

Click to download the PDB-style file with coordinates for d2vypa2.
(The format of our PDB-style files is described here.)

Timeline for d2vypa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2vypa1