SCOPe 2.06: Domain d1dqta_: 1dqt A:

Lineage for d1dqta_ (1dqt A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoreceptor CTLA-4 (CD152), N-terminal fragment [48939] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [48941] (3 PDB entries)

8. Domain d1dqta_: 1dqt A: [20653]
   complexed with cl, edo

Details for d1dqta_

PDB Entry: 1dqt, 2 Å

PDB Description: the crystal structure of murine ctla4 (cd152)

PDB Compounds: (A:) cytotoxic t lymphocyte associated antigen 4

SCOPe Domain Sequences for d1dqta_:

Sequence; same for both SEQRES and ATOM records:

>d1dqta_ b.1.1.1 (A:) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Mouse (Mus musculus) [TaxId: 10090]}
iqvtqpsvvlasshgvasfpceyspshntdevrvtvlrqtndqmtevcattftekntvgf
ldypfcsgtfnesrvnltiqglravdtglylckvelmypppyfvgmgngtqiyvidp

Timeline for d1dqta_:

• d1dqta_ first appeared (with stable ids) in SCOP 1.55
  
• d1dqta_ appears in SCOPe 2.05
  
• d1dqta_ appears in SCOPe 2.07
  
• d1dqta_ appears in the current release, SCOPe 2.08