SCOPe 2.08: Domain d2vxum1: 2vxu M:1-107

Lineage for d2vxum1 (2vxu M:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d2vxum1: 2vxu M:1-107 [206528]
   Other proteins in same PDB: d2vxuh_, d2vxui_, d2vxul2, d2vxum2
   automated match to d1dqdl1

Details for d2vxum1

PDB Entry: 2vxu, 2.36 Å

PDB Description: crystal structure of murine reference antibody 125-2h fab fragment

PDB Compounds: (M:) murine igg 125-2h

SCOPe Domain Sequences for d2vxum1:

Sequence; same for both SEQRES and ATOM records:

>d2vxum1 b.1.1.0 (M:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
diqmtqspsslsaslgervsltcrasqdigsklywlqqepdgtfkrliyatssldsgvpk
rfsgsrsgsdysltisslesedfvdyyclqyasspytfgggtklaik

Timeline for d2vxum1:

• d2vxum1 first appeared in SCOPe 2.03
  
• d2vxum1 appears in SCOPe 2.07