SCOPe 2.08: Domain d2vxul2: 2vxu L:108-214

Lineage for d2vxul2 (2vxu L:108-214)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d2vxul2: 2vxu L:108-214 [206527]
   Other proteins in same PDB: d2vxuh_, d2vxui_, d2vxul1, d2vxum1
   automated match to d1dqdl2

Details for d2vxul2

PDB Entry: 2vxu, 2.36 Å

PDB Description: crystal structure of murine reference antibody 125-2h fab fragment

PDB Compounds: (L:) murine igg 125-2h

SCOPe Domain Sequences for d2vxul2:

Sequence; same for both SEQRES and ATOM records:

>d2vxul2 b.1.1.2 (L:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d2vxul2:

• d2vxul2 first appeared in SCOPe 2.03
  
• d2vxul2 appears in SCOPe 2.07