SCOPe 2.03: Domain d2vxsm2: 2vxs M:109-212

Lineage for d2vxsm2 (2vxs M:109-212)

Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (12 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (293 PDB entries)
Domain d2vxsm2: 2vxs M:109-212 [206521]
Other proteins in same PDB: d2vxsl1, d2vxsm1, d2vxsn1, d2vxso1
automated match to d1adql2
complexed with so4

Details for d2vxsm2

PDB Entry: 2vxs (more details), 2.63 Å

PDB Description: structure of il-17a in complex with a potent, fully human neutralising antibody

PDB Compounds: (M:) fab fragment

SCOPe Domain Sequences for d2vxsm2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vxsm2 b.1.1.2 (M:109-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvaptec

SCOPe Domain Coordinates for d2vxsm2:

Click to download the PDB-style file with coordinates for d2vxsm2.
(The format of our PDB-style files is described here.)

Timeline for d2vxsm2: