Lineage for d2vxsm1 (2vxs M:1-108)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2756445Domain d2vxsm1: 2vxs M:1-108 [206520]
    Other proteins in same PDB: d2vxsh_, d2vxsi_, d2vxsj_, d2vxsk_, d2vxsl2, d2vxsm2, d2vxsn2, d2vxso2
    automated match to d1adql1
    complexed with so4

Details for d2vxsm1

PDB Entry: 2vxs (more details), 2.63 Å

PDB Description: structure of il-17a in complex with a potent, fully human neutralising antibody
PDB Compounds: (M:) fab fragment

SCOPe Domain Sequences for d2vxsm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vxsm1 b.1.1.0 (M:1-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nfmltqphsvsespgktvtisctrssgslanyyvqwyqqrpgssptivifannqrpsgvp
drfsgsidsssnsasltisglktedeadyycqtydpysvvfgggtkltvlg

SCOPe Domain Coordinates for d2vxsm1:

Click to download the PDB-style file with coordinates for d2vxsm1.
(The format of our PDB-style files is described here.)

Timeline for d2vxsm1: