![]() | Class b: All beta proteins [48724] (141 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins) |
![]() | Protein Immunoreceptor CTLA-4 (CD152), N-terminal fragment [48939] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [48940] (3 PDB entries) |
![]() | Domain d1ah1__: 1ah1 - [20652] complexed with fuc, man, nag |
PDB Entry: 1ah1 (more details)
SCOP Domain Sequences for d1ah1__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ah1__ b.1.1.1 (-) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Human (Homo sapiens)} amhvaqpavvlassrgiasfvceyaspgkatevrvtvlrqadsqvtevcaatymmgnelt flddsictgtssgnqvnltiqglramdtglyickvelmypppyylgigngtqiyvidpep cpdsdqepk
Timeline for d1ah1__: