Lineage for d1tvdb_ (1tvd B:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 103212Protein T-cell antigen receptor [48933] (6 species)
  7. 103227Species Human (Homo sapiens), delta-chain [TaxId:9606] [48938] (2 PDB entries)
  8. 103229Domain d1tvdb_: 1tvd B: [20651]

Details for d1tvdb_

PDB Entry: 1tvd (more details), 1.9 Å

PDB Description: variable domain of t cell receptor delta chain

SCOP Domain Sequences for d1tvdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tvdb_ b.1.1.1 (B:) T-cell antigen receptor {Human (Homo sapiens), delta-chain}
dkvtqsspdqtvasgsevvllctydtvysnpdlfwyrirpdysfqfvfygddsrsegadf
tqgrfsvkhiltqkafhlvispvrtedsatyycaftlppptdklifgkgtrvtvep

SCOP Domain Coordinates for d1tvdb_:

Click to download the PDB-style file with coordinates for d1tvdb_.
(The format of our PDB-style files is described here.)

Timeline for d1tvdb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1tvda_