Lineage for d1tvdb_ (1tvd B:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) 
Protein T-cell antigen receptor [48933] (6 species)
sequences may differ within each classified species
Species Human (Homo sapiens), delta-chain [TaxId:9606] [48938] (3 PDB entries) 
Domain d1tvdb_: 1tvd B: [20651]
Details for d1tvdb_
PDB Entry: 1tvd (more details), 1.9 Å
PDB Description: variable domain of t cell receptor delta chain
PDB Compounds: (B:) t cell receptorSCOPe Domain Sequences for d1tvdb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tvdb_ b.1.1.1 (B:) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]}
dkvtqsspdqtvasgsevvllctydtvysnpdlfwyrirpdysfqfvfygddsrsegadf
tqgrfsvkhiltqkafhlvispvrtedsatyycaftlppptdklifgkgtrvtvep
SCOPe Domain Coordinates for d1tvdb_:
Click to download the PDB-style file with coordinates for d1tvdb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1tvdb_:
- d1tvdb_ first appeared (with stable ids) in SCOP 1.55
- d1tvdb_ appears in SCOPe 2.07
View in 3D
