| Root: SCOP 1.65 |
| Class b: All beta proteins [48724] (126 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins) |
| Protein T-cell antigen receptor [48933] (6 species) sequences may differ within each classified species |
| Species Human (Homo sapiens), delta-chain [TaxId:9606] [48938] (2 PDB entries) |
| Domain d1tvda_: 1tvd A: [20650] |
PDB Entry: 1tvd (more details), 1.9 Å
SCOP Domain Sequences for d1tvda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tvda_ b.1.1.1 (A:) T-cell antigen receptor {Human (Homo sapiens), delta-chain}
dkvtqsspdqtvasgsevvllctydtvysnpdlfwyrirpdysfqfvfygddsrsegadf
tqgrfsvkhiltqkafhlvispvrtedsatyycaftlppptdklifgkgtrvtvep
Timeline for d1tvda_: