![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.121: Ribose/Galactose isomerase RpiB/AlsB [89622] (1 superfamily) 3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 21354; topological similarity to a part of the arginase/deacetylase fold |
![]() | Superfamily c.121.1: Ribose/Galactose isomerase RpiB/AlsB [89623] (2 families) ![]() |
![]() | Family c.121.1.0: automated matches [191649] (1 protein) not a true family |
![]() | Protein automated matches [191196] (11 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [226818] (1 PDB entry) |
![]() | Domain d2vvrf_: 2vvr F: [206499] automated match to d3k7sa_ mutant |
PDB Entry: 2vvr (more details), 2.1 Å
SCOPe Domain Sequences for d2vvrf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vvrf_ c.121.1.0 (F:) automated matches {Escherichia coli K-12 [TaxId: 83333]} mkkiafgcdhvgfilkheivahlvergvevidkgtwssertdyphyasqvalavaggevd ggilicgtgvgisiaankfagiravvcsepysaqlsrqnndtnvlafgsrvvglelakmi vdawlgaqyeggrhqqrveaitaieq
Timeline for d2vvrf_: